General Information

  • ID:  hor006492
  • Uniprot ID:  Q9U8R2
  • Protein name:  Androgenic gland hormone A chain
  • Gene name:  NA
  • Organism:  Armadillidium vulgare (Pillbug) (Pill woodlouse)
  • Family:  NA
  • Source:  animal
  • Expression:  Androgenic gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Armadillidium (genus), Armadillidiidae (family), Crinocheta , Oniscidea (suborder), Isopoda (order), Peracarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007283 spermatogenesis; GO:0007548 sex differentiation; GO:0030154 cell differentiation
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  EIAFYQECCNIRTEHKCNRTTVSLYCRTY
  • Length:  29
  • Propeptide:  MKGLVILVSLMCLALYNRICAYQVRGMRSDVLCGDIRFTVQCICNELGYFPTERLDKPCPWPNREKRSAPEDELAFEDYEDQDYFHPRALSIPSEIEHDNEKESDAFSILSRGKREIAFYQECCNIRTEHKCNRTTVSLYCRTY
  • Signal peptide:  MKGLVILVSLMCLALYNRICA
  • Modification:  NA
  • Glycosylation:  T18 N-linked (GlcNAc...) (complex) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Controls sex differentiation and the formation of male appendages, spermatogenesis, pigmentation, and male specific behavior.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  9-17
  • Structure ID:  AF-Q9U8R2-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006492_AF2.pdbhor006492_ESM.pdb

Physical Information

Mass: 404563 Formula: C151H234N44O47S4
Absent amino acids: DGMPW Common amino acids: CT
pI: 7.93 Basic residues: 5
Polar residues: 14 Hydrophobic residues: 6
Hydrophobicity: -60.34 Boman Index: -7961
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 53.79
Instability Index: 7668.97 Extinction Coefficient cystines: 4720
Absorbance 280nm: 168.57

Literature

  • PubMed ID:  10529379
  • Title:  Characterization and cDNA cloning of androgenic gland hormone of the terrestrial isopod Armadillidium vulgare.
  • PubMed ID:  10411634
  • Title:  The structure of a glycosylated protein hormone responsible for sex determination in the isopod, Armadillidium vulgare.